Independent lab report on every lot•Certificates published before purchase•Net content tested, not just purity•Free shipping on every order•Dispatched from Dubai · GCC express•Plain, unmarked outer packaging•Independent lab report on every lot•Certificates published before purchase•Net content tested, not just purity•Free shipping on every order•Dispatched from Dubai · GCC express•Plain, unmarked outer packaging•
For laboratory research use only — not for human or veterinary use
emitide
Cart 0
All products 24 Peptide vials 15Nasal sprays 2Peptide pens & devices 4Lab supplies 7Blends & stacks 4 Lab results COA

Home / Catalogue / Peptide vials / Sermorelin

Sermorelin

Sermorelin

Independently tested · report per lotCertificate published before purchase

Reference-grade Sermorelin, lyophilized vial. Research use only.

Volume pricing Applied automatically at checkout
QuantityPer unitYou save

Volume and subscription discounts do not stack — you get whichever is larger.

Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular formula
C149H246N44O42S
Molar mass
3357.9 g/mol
CAS
86168-78-7
Form
lyophilized vial
Net content
5 mg
Storage
-20°C, desiccated

50 in stock

For laboratory research use only. Not for human or veterinary use, or any form of consumption.

SKU: EMT-SERMORELIN-VIAL Categories: , Tag:
Free shipping on every order, no minimumDispatched from Dubai, same working day before 16:00 GSTCertificate for this lot published before it goes on salePlain, unmarked outer packaging

Safety data sheet for this product →

Complete your setup

Supplies only, and nothing is selected for you. We do not provide reconstitution or usage guidance — see our contact policy.

Nothing selected

Analytical profile

Verified against PubChem, UniProt, ChEBI, regulatory labelling and peer-reviewed literature — not copied from another vendor's catalogue. Identity of the material actually shipped is confirmed per lot.

Written out
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Termini and modifications
Free N-terminal amine; C-terminus amidated.
Residues
29
What it is
Truncated analogue — the N-terminal 1–29 segment of human GHRH(1-44). The C-terminal amide is synthetic; native GHRH is amidated at Leu44, not Arg29.

Worth knowing before you buy

A CAS of 114466-38-5 is widely quoted for "sermorelin acetate" but returns no record in PubChem or the EPA CompTox dashboard. Treat it with suspicion.

Peptides of this class are supplied as acetate or trifluoroacetate salts, so gross powder weight exceeds net peptide content. The figure on our label and certificate is the peptide mass. What we test, and what we do not →

Certificate of analysis

Proof before purchase.

Each lot is tested by an independent laboratory and the report is published here — readable before you add to cart, not emailed after you pay.

publishing at launch · COA
TestMethodResult
PurityHPLC-UVpublishing at launch
Net contentGravimetricpublishing at launch
Batch—assigned at first lot

Launch panel: HPLC purity and gravimetric net content, run per lot by an independent laboratory and published here before purchase. Identity, endotoxin, sterility and heavy metals are not on the launch panel — we do not list a test we have not run.

Description

Sermorelin is a 29-amino-acid amidated analogue of the N-terminal fragment of human growth-hormone-releasing hormone.

  • Sequence — YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
  • Molecular formula — C149H246N44O42S
  • Molar mass — 3357.9 g/mol
  • CAS — 86168-78-7

Supplied as a lyophilized powder in a sealed glass vial. Store at −20 °C, desiccated and protected from light.

Peptides of this class are supplied as acetate or TFA salts, so gross vial weight exceeds net peptide content. The net content figure on our certificate is the peptide mass, measured gravimetrically.

Each lot is tested by an independent laboratory for HPLC purity and gravimetric net content. The report is published on this page and readable before purchase.

Described by identity only. For laboratory research use only — not for human or veterinary use, or any form of consumption.

Related products

01
Report on every lotIndependent laboratory
02
Net content testedGravimetric, not just purity
03
Free shippingEvery order, no minimum
04
Tabby, Tamara & cryptoEight payment methods
05
Plain outer packagingNo branding on the box

Before you buy

Read the report first.

Every certificate is public and ungated — no account, no email address, no asking. Proof you have to request isn't proof.

See lab results →
WhatsApp